PDB entry 3b0r

View 3b0r on RCSB PDB site
Description: Human PPAR gamma ligand binding dmain complexed with GW9662 in a covalent bonded form
Class: transcription
Keywords: Nuclear Receptor, TRANSCRIPTION
Deposited on 2011-06-13, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b0ra_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b0rb_
  • Heterogens: GW9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b0rA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b0rA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedks
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
    vikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b0rB (B:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b0rB (B:)
    esadlralakhlydsyiksfpltkakarailtgdkspfviydmnslmmgedkikevairi
    fqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvli
    segqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgll
    nvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkhpl
    lqeiy