PDB entry 3b0i

View 3b0i on RCSB PDB site
Description: Crystal structure of recombinant human alpha lactalbumin
Class: metal binding protein
Keywords: Calcium Binding Protein, Glycoprotein, METAL BINDING PROTEIN
Deposited on 2011-06-10, released 2012-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Homo sapiens [TaxId:9606]
    Gene: LALBA, LYZL7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00709 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3b0ia1, d3b0ia2
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b0iA (A:)
    mkqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
    wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
    cekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b0iA (A:)
    mkqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
    wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
    c