PDB entry 3b0f

View 3b0f on RCSB PDB site
Description: Crystal structure of the UBA domain of p62 and its interaction with ubiquitin
Class: protein binding
Keywords: Ubiquitin, Autophagy, PROTEIN BINDING
Deposited on 2011-06-09, released 2011-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sequestosome-1
    Species: Mus musculus [TaxId:10090]
    Gene: Sqstm1, A170, STAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b0fa_
  • Chain 'B':
    Compound: Sequestosome-1
    Species: Mus musculus [TaxId:10090]
    Gene: Sqstm1, A170, STAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b0fb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3b0fA (A:)
gplgseadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

    Sequence, based on observed residues (ATOM records): (download) 
    >3b0fA (A:)
dprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqy

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3b0fB (B:)
gplgseadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

    Sequence, based on observed residues (ATOM records): (download) 
    >3b0fB (B:)
dprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqy