PDB entry 3b01

View 3b01 on RCSB PDB site
Description: Crystal structure of the laminarinase catalytic domain from Thermotoga maritima MSB8
Class: hydrolase
Keywords: beta-jelly roll fold, Glycosyl hydrolase family 16, Laminarinase, Endo-1,3-beta-glucanase, HYDROLASE
Deposited on 2011-06-03, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.153
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laminarinase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b01a_
  • Chain 'B':
    Compound: Laminarinase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b01b_
  • Chain 'C':
    Compound: Laminarinase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b01c_
  • Chain 'D':
    Compound: Laminarinase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b01d_
  • Heterogens: CA, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b01A (A:)
    mededkvedwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafven
    gclviearkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgn
    nigevgwptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhi
    fsiewdedevewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdett
    qfpqrmyidyirvykdmnpetitgvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b01A (A:)
    edwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviea
    rkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgw
    ptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewde
    devewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdettqfpqrmy
    idyirvykdmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b01B (B:)
    mededkvedwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafven
    gclviearkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgn
    nigevgwptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhi
    fsiewdedevewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdett
    qfpqrmyidyirvykdmnpetitgvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b01B (B:)
    dwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviear
    keqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgwp
    tcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewded
    evewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdettqfpqrmyi
    dyirvykdmn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b01C (C:)
    mededkvedwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafven
    gclviearkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgn
    nigevgwptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhi
    fsiewdedevewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdett
    qfpqrmyidyirvykdmnpetitgvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b01C (C:)
    edwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviea
    rkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgw
    ptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewde
    devewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdettqfpqrmy
    idyirvykdmn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b01D (D:)
    mededkvedwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafven
    gclviearkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgn
    nigevgwptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhi
    fsiewdedevewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdett
    qfpqrmyidyirvykdmnpetitgvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b01D (D:)
    edwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviea
    rkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgw
    ptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewde
    devewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdettqfpqrmy
    idyirvykdmn