PDB entry 3azb

View 3azb on RCSB PDB site
Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS91-11
Class: lyase/inhibitor
Keywords: hot dog fold, FabZ, beta-hydroxyacyl acyl carrier protein dehydratase, Lyase, acyl carrier protein, LYASE-INHIBITOR complex
Deposited on 2011-05-21, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azba_
  • Chain 'B':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbb_
  • Chain 'C':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbc_
  • Chain 'D':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbd_
  • Chain 'E':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbe_
  • Chain 'F':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbf_
  • Chain 'G':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbg_
  • Chain 'H':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbh_
  • Chain 'I':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbi_
  • Chain 'J':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbj_
  • Chain 'K':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbk_
  • Chain 'L':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbl_
  • Chain 'M':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbm_
  • Chain 'N':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbn_
  • Chain 'O':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbo_
  • Chain 'P':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbp_
  • Chain 'Q':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbq_
  • Chain 'R':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbr_
  • Chain 'S':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbs_
  • Chain 'T':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbt_
  • Chain 'U':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbu_
  • Chain 'V':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbv_
  • Chain 'W':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbw_
  • Chain 'X':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azbx_
  • Heterogens: GOL, KM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3azbA (A:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbA (A:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3azbB (B:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbB (B:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3azbC (C:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbC (C:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3azbD (D:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbD (D:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakl
    sgvgyvngkvvinisemtfa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3azbE (E:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbE (E:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3azbF (F:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbF (F:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3azbG (G:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbG (G:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3azbH (H:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbH (H:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3azbI (I:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbI (I:)
    sidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlq
    iealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgia
    klsgvgyvngkvvinisemtfal
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3azbJ (J:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbJ (J:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakl
    sgvgyvngkvvinisemtfa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3azbK (K:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbK (K:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3azbL (L:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbL (L:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3azbM (M:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbM (M:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3azbN (N:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbN (N:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3azbO (O:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbO (O:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3azbP (P:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbP (P:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakl
    sgvgyvngkvvinisemtfa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3azbQ (Q:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbQ (Q:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3azbR (R:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbR (R:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3azbS (S:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbS (S:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3azbT (T:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbT (T:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3azbU (U:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbU (U:)
    sidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlq
    iealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgia
    klsgvgyvngkvvinisemtfal
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3azbV (V:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbV (V:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakl
    sgvgyvngkvvinisemtfa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3azbW (W:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbW (W:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3azbX (X:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azbX (X:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals