PDB entry 3aza

View 3aza on RCSB PDB site
Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS91-10
Class: lyase/inhibitor
Keywords: hot dog fold, FabZ, beta-hydroxyacyl acyl carrier protein dehydratase, Lyase, acyl carrier protein, LYASE-INHIBITOR complex
Deposited on 2011-05-21, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azaa_
  • Chain 'B':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azab_
  • Chain 'C':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azac_
  • Chain 'D':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azad_
  • Chain 'E':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azae_
  • Chain 'F':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azaf_
  • Chain 'G':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azag_
  • Chain 'H':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azah_
  • Chain 'I':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azai_
  • Chain 'J':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azaj_
  • Chain 'K':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azak_
  • Chain 'L':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azal_
  • Chain 'M':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azam_
  • Chain 'N':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azan_
  • Chain 'O':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azao_
  • Chain 'P':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azap_
  • Chain 'Q':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azaq_
  • Chain 'R':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azar_
  • Chain 'S':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azas_
  • Chain 'T':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azat_
  • Chain 'U':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azau_
  • Chain 'V':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azav_
  • Chain 'W':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azaw_
  • Chain 'X':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azax_
  • Heterogens: GOL, KM0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3azaA (A:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaA (A:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3azaB (B:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaB (B:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3azaC (C:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaC (C:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3azaD (D:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaD (D:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3azaE (E:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaE (E:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3azaF (F:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaF (F:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3azaG (G:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaG (G:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3azaH (H:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaH (H:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3azaI (I:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaI (I:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3azaJ (J:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaJ (J:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3azaK (K:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaK (K:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3azaL (L:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaL (L:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3azaM (M:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaM (M:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3azaN (N:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaN (N:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3azaO (O:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaO (O:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3azaP (P:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaP (P:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3azaQ (Q:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaQ (Q:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3azaR (R:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaR (R:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3azaS (S:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaS (S:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3azaT (T:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaT (T:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3azaU (U:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaU (U:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3azaV (V:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaV (V:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakl
    sgvgyvngkvvinisemtfa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3azaW (W:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaW (W:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3azaX (X:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azaX (X:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals