PDB entry 3az9

View 3az9 on RCSB PDB site
Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS91
Class: lyase/inhibitor
Keywords: hot dog fold, FabZ,beta-hydroxyacyl acyl carrier protein dehydratase, Lyase, acyl carrier protein, LYASE-INHIBITOR complex
Deposited on 2011-05-21, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.236
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9a_
  • Chain 'B':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9b_
  • Chain 'C':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9c_
  • Chain 'D':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9d_
  • Chain 'E':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9e_
  • Chain 'F':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9f_
  • Chain 'G':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9g_
  • Chain 'H':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9h_
  • Chain 'I':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9i_
  • Chain 'J':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9j_
  • Chain 'K':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9k_
  • Chain 'L':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9l_
  • Chain 'M':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9m_
  • Chain 'N':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9n_
  • Chain 'O':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9o_
  • Chain 'P':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9p_
  • Chain 'Q':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9q_
  • Chain 'R':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9r_
  • Chain 'S':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9s_
  • Chain 'T':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9t_
  • Chain 'U':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9u_
  • Chain 'V':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9v_
  • Chain 'W':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9w_
  • Chain 'X':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3az9x_
  • Heterogens: GOL, PO4, K91, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3az9A (A:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9A (A:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3az9B (B:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9B (B:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3az9C (C:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9C (C:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3az9D (D:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9D (D:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3az9E (E:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9E (E:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3az9F (F:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9F (F:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3az9G (G:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9G (G:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfalsk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3az9H (H:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9H (H:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3az9I (I:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9I (I:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3az9J (J:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9J (J:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3az9K (K:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9K (K:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3az9L (L:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9L (L:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3az9M (M:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9M (M:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3az9N (N:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9N (N:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3az9O (O:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9O (O:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3az9P (P:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9P (P:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3az9Q (Q:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9Q (Q:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3az9R (R:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9R (R:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3az9S (S:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9S (S:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3az9T (T:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9T (T:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3az9U (U:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9U (U:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3az9V (V:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9V (V:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3az9W (W:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9W (W:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfal
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3az9X (X:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az9X (X:)
    diedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqie
    alaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiakl
    sgvgyvngkvvinisemtfals