PDB entry 3az8

View 3az8 on RCSB PDB site
Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS21
Class: lyase/inhibitor
Keywords: FabZ, Plasmodium falciparum, beta-hydroxyacyl acyl carrier protein dehydratase, hot dog fold, Lyase, LYASE-INHIBITOR complex
Deposited on 2011-05-20, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.209
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8a_
  • Chain 'B':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8b_
  • Chain 'C':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8c_
  • Chain 'D':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8d_
  • Chain 'E':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8e_
  • Chain 'F':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8f_
  • Chain 'G':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8g_
  • Chain 'H':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8h_
  • Chain 'I':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8i_
  • Chain 'J':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8j_
  • Chain 'K':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8k_
  • Chain 'L':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8l_
  • Chain 'M':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8m_
  • Chain 'N':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8n_
  • Chain 'O':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8o_
  • Chain 'P':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8p_
  • Chain 'Q':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8q_
  • Chain 'R':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8r_
  • Chain 'S':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8s_
  • Chain 'T':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8t_
  • Chain 'U':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8u_
  • Chain 'V':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8v_
  • Chain 'W':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8w_
  • Chain 'X':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3az8x_
  • Heterogens: GOL, PEG, CL, S21, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3az8A (A:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8A (A:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3az8B (B:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8B (B:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3az8C (C:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8C (C:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3az8D (D:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8D (D:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakl
    sgvgyvngkvvinisemtfa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3az8E (E:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8E (E:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksgia
    klsgvgyvngkvvinisemtfal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3az8F (F:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8F (F:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3az8G (G:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8G (G:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3az8H (H:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8H (H:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkiakls
    gvgyvngkvvinisemtfals
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3az8I (I:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8I (I:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkslgia
    klsgvgyvngkvvinisemtfal
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3az8J (J:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8J (J:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3az8K (K:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8K (K:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfal
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3az8L (L:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8L (L:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3az8M (M:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8M (M:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfal
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3az8N (N:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8N (N:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3az8O (O:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8O (O:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3az8P (P:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8P (P:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfal
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3az8Q (Q:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8Q (Q:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3az8R (R:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8R (R:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3az8S (S:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8S (S:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfals
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3az8T (T:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8T (T:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiakl
    sgvgyvngkvvinisemtfals
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3az8U (U:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8U (U:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfal
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3az8V (V:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8V (V:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
    iaklsgvgyvngkvvinisemtfa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3az8W (W:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8W (W:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiak
    lsgvgyvngkvvinisemtfal
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3az8X (X:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3az8X (X:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
    aklsgvgyvngkvvinisemtfals