PDB entry 3ayu

View 3ayu on RCSB PDB site
Description: crystal structure of mmp-2 active site mutant in complex with app- drived decapeptide inhibitor
Deposited on 2011-05-17, released 2011-08-03
The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 72 kda type IV collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP2, CLG4A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (0-109)
      • engineered mutation (107)
      • engineered mutation (109)
    • Uniprot P08253 (110-End)
      • engineered mutation (120)
  • Chain 'B':
    Compound: amyloid beta a4 protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ayuA (A:)
ynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgeadi
minfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgkgvgyslflvaah
afghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd

    Sequence, based on observed residues (ATOM records):
    >3ayuA (A:)
ynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgeadi
minfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgkgvgyslflvaah
afghamglehsqdpgalmapiytytknfrlsqddikgiqelygasp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3ayuB (B:)
isygndalmp