PDB entry 3ayq

View 3ayq on RCSB PDB site
Description: crystal structure of inhibitor bound lysozyme from meretrix lusoria
Deposited on 2011-05-13, released 2012-05-23
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Meretrix lusoria [TaxId:74491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86383 (0-121)
      • see remark 999 (4)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ayqA (A:)
faggtvsqrclscickmesgcrnvgckmdmgslscgyfqikeaywidcgrpgsswkscaa
ssycaslcvqnymkryakwagcplrcegfarehnggprgckkgstigywnrlqkisgchg
vq