PDB entry 3ayk

View 3ayk on RCSB PDB site
Description: catalytic fragment of human fibroblast collagenase complexed with cgs- 27023a, nmr, minimized average structure
Deposited on 1999-02-01, released 1999-06-07
The last revision prior to the SCOP 1.59 freeze date was dated 1999-06-07, with a file datestamp of 1999-06-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d3ayka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aykA (A:)
    prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
    dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
    shstdigalmypsytfsgdvqlaqddidgiqaiygrs