PDB entry 3ayc

View 3ayc on RCSB PDB site
Description: Crystal structure of galectin-3 CRD domian complexed with GM1 pentasaccharide
Class: sugar binding protein
Keywords: Rossmann Fold, a beta-galactose-binding protein, beta-galactosides, cell-surface, nuclear, SUGAR BINDING PROTEIN
Deposited on 2011-05-04, released 2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (1-134)
      • expression tag (0)
    Domains in SCOPe 2.08: d3ayca1, d3ayca2
  • Chain 'B':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (1-134)
      • expression tag (0)
    Domains in SCOPe 2.08: d3aycb1, d3aycb2
  • Heterogens: GOL, SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aycA (A:)
    mpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivcnt
    kldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisklg
    isgdidltsasytmi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aycB (B:)
    mpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivcnt
    kldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisklg
    isgdidltsasytmi