PDB entry 3ay7

View 3ay7 on RCSB PDB site
Description: Crystal structure of Bacillus megaterium glucose dehydrogenase 4 G259A mutant
Class: oxidoreductase
Keywords: Rossmann Fold, Oxidation-reduction process, Nucleotide binding, Cytosol, OXIDOREDUCTASE
Deposited on 2011-04-29, released 2012-05-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose 1-dehydrogenase 4
    Species: Bacillus megaterium [TaxId:1404]
    Gene: gdhIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39485 (8-End)
      • expression tag (7)
      • engineered mutation (266)
    Domains in SCOPe 2.03: d3ay7a_
  • Chain 'B':
    Compound: Glucose 1-dehydrogenase 4
    Species: Bacillus megaterium [TaxId:1404]
    Gene: gdhIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39485 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.03: d3ay7b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ay7A (A:)
    mghhhhhhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkev
    eeaggqaiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkv
    idtnltgaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetl
    aleyapkgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaafla
    ssqasyvtgitlfadggmtkypsfqaarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ay7A (A:)
    hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
    iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
    aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
    girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
    tgitlfadggmtkypsfqaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ay7B (B:)
    mghhhhhhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkev
    eeaggqaiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkv
    idtnltgaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetl
    aleyapkgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaafla
    ssqasyvtgitlfadggmtkypsfqaarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ay7B (B:)
    hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
    iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
    aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
    girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
    tgitlfadggmtkypsfqa