PDB entry 3ay4

View 3ay4 on RCSB PDB site
Description: Crystal structure of nonfucosylated Fc complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa
Class: immune system
Keywords: immune system, complex, fc fragment, igg, receptor, cd16, gamma
Deposited on 2011-04-28, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ay4a1, d3ay4a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ay4b1, d3ay4b2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (71)
      • see remark 999 (155)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d3ay4c1, d3ay4c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ay4A (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ay4A (A:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnak
    tkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqv
    ytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ay4B (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ay4B (B:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnak
    tkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqv
    ytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ay4C (C:)
    edlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaat
    vddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvt
    ylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ay4C (C:)
    lpkavvflepqwyrvlekdsvtlkcqqwfhneslissqassyfidaatvddsgeyrcqtq
    lstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfh
    hnsdfyipkatlkdsgsyfcrglvgsknvssetvqititq