PDB entry 3axz

View 3axz on RCSB PDB site
Description: Crystal structure of Haemophilus influenzae TrmD in complex with adenosine
Class: transferase
Keywords: trefoil knot, methyltransferase, AdoMet binding, transferase
Deposited on 2011-04-21, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: HI_0202, trmD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43912 (20-265)
      • expression tag (14-19)
    Domains in SCOPe 2.07: d3axza1, d3axza2
  • Heterogens: ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3axzA (A:)
    mgsshhhhhhssglvprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprd
    ftfdkhktvddrpygggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvt
    elaqnqklilvcgryegiderliqteideewsigdyvltggelpamtlidavarfipgvl
    gkqasaeedsfadglldcphytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrr
    pelleglaltdeqrkllkeaqaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axzA (A:)
    vprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpy
    gggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgr
    yegiderliqteideewsigdyvltggelpamtlidavarfipgvladglldcphytrpe
    vlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehn
    s