PDB entry 3axw

View 3axw on RCSB PDB site
Description: Crystal structure of human CK2alpha complexed with a potent inhibitor
Class: transferase/transferase inhibitor
Keywords: kinase domain, serine/threonine kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-04-18, released 2012-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.268
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3axwa_
  • Heterogens: TID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3axwA (A:)
    gplgsmsgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfe
    ainitnnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfeh
    vnntdfkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlid
    wglaefyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhg
    hdnydqlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvsp
    ealdfldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axwA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkd