PDB entry 3axk

View 3axk on RCSB PDB site
Description: Structure of rice Rubisco in complex with NADP(H)
Class: Lyase
Keywords: alpha/beta barrel, photosynthetic carbon reduction, Lyase
Deposited on 2011-04-11, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axka1, d3axka2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axkb1, d3axkb2
  • Chain 'S':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
      • conflict (111)
    Domains in SCOPe 2.07: d3axks_
  • Chain 'T':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
      • conflict (111)
    Domains in SCOPe 2.07: d3axkt_
  • Heterogens: GOL, MG, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3axkA (A:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axkA (A:)
    ykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaessttvwtdgltsldrykgr
    cyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippt
    ysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkdd
    envnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvp
    ivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsgg
    dhihagtvveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmp
    alteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsa
    ckwspelaaaceiw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3axkB (B:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axkB (B:)
    kltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstwtdgltsldrykgrcyh
    iepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlripptysk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenv
    nsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhi
    hagteremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpaltei
    fgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsackwsp
    elaaaceiwk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3axkS (S:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axkS (S:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp
    p
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3axkT (T:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axkT (T:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp