PDB entry 3ax9

View 3ax9 on RCSB PDB site
Description: Bovine xanthone oxidase, protease cleaved form
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-03-31, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ax9A (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ax9A (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakpkqlrfegervtwiqa
    stlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisf
    gaacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspis
    dlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffs
    afkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwn
    ekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgdtvgrplphla
    aamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddip
    gsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpaiitieda
    iknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipkgeegeme
    lfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvavalaayktgh
    pvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdlshsimera
    lfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtcglpaeev
    rwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwkkrglcii
    ptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskalkipiski
    yisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswedwvmaay
    qdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknlrtdivmd
    vgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgsiptefrv
    sllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelfrldspat
    pekirnacvdkfttlcvtgapgnck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ax9B (B:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ax9B (B:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakpkqlrfegervtwiqa
    stlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisf
    gaacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspis
    dlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffs
    afkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwn
    ekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgdtvgrplphla
    aamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddip
    gsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpaiitieda
    iknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipkgeegeme
    lfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvavalaayktgh
    pvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdlshsimera
    lfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtcglpaeev
    rwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwkkrglcii
    ptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskalkipiski
    yisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswedwvmaay
    qdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknlrtdivmd
    vgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgsiptefrv
    sllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelfrldspat
    pekirnacvdkfttlcvt