PDB entry 3awo

View 3awo on RCSB PDB site
Description: Crystal structure of D-serine dehydratase in complex with D-serine from chicken kidney (EDTA-treated)
Class: lyase
Keywords: PLP-dependent fold-type III enzyme, D-serine dehydratase, PLP binding, LYASE
Deposited on 2011-03-25, released 2011-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-serine dehydratase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3awoa1, d3awoa2
  • Heterogens: PLP, DSN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3awoA (A:)
    mwlgalldtlptpaltidrttarrnaermrercralgvrlrphvkthktleggllatggt
    rrgiavstlaearffadggfddillaypvptarleecaglarrldafhvlldrpealasl
    rqrplghgkrwlvwlkldcgngragvrptdpaalelaqaiandapeevtlvgvyahcgnt
    ygcsgadtiqaiartttnavlsfvaalrqagvpcpqasigstpscshpipemsqltelhp
    gnyifydlqqtqlgscqpqdvairvltrvighyahrgqllvdcgwaalslhgagagqgpq
    gcaaidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyv
    heegkvvalwhpvrgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3awoA (A:)
    mwlgalldtlptpaltidrttarrnaermrercralgvrlrphvkthktleggllatggt
    rrgiavstlaearffadggfddillaypvptarleecaglarrldafhvlldrpealasl
    rqrplghgkrwlvwlkldcgragvrptdpaalelaqaiandapeevtlvgvyahcgntyg
    csgadtiqaiartttnavlsfvaalrqagvpcpqasigstpscshpipemsqltelhpgn
    yifydlqqtqlgscqpqdvairvltrvighyahrgqllvdcgwaalslhgaggpqgcaai
    dghpelrlvgltqehgllehqmdfgrfpvgsvlalipyhacataamhpvyyvheegkvva
    lwhpvrgw