PDB entry 3awh

View 3awh on RCSB PDB site
Description: E13K mutant of FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)
Class: flavoprotein
Keywords: flavoprotein
Deposited on 2011-03-22, released 2012-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d3awha_
  • Chain 'B':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d3awhb_
  • Heterogens: FMN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3awhA (A:)
    mlpgtffevlknkgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3awhB (B:)
    mlpgtffevlknkgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl