PDB entry 3av8

View 3av8 on RCSB PDB site
Description: Refined Structure of Plant-type [2Fe-2S] Ferredoxin I from Aphanothece sacrum at 1.46 A Resolution
Class: electron transport
Keywords: Beta-grasp, Redox Protein, ELECTRON TRANSPORT
Deposited on 2011-02-28, released 2012-01-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.187
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-1
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AV8 (0-96)
    Domains in SCOPe 2.03: d3av8a_
  • Chain 'B':
    Compound: Ferredoxin-1
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AV8 (0-96)
    Domains in SCOPe 2.03: d3av8b_
  • Chain 'C':
    Compound: Ferredoxin-1
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AV8 (0-96)
    Domains in SCOPe 2.03: d3av8c_
  • Chain 'D':
    Compound: Ferredoxin-1
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AV8 (0-96)
    Domains in SCOPe 2.03: d3av8d_
  • Heterogens: FES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3av8A (A:)
    asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
    dqsfldddqiqagyiltcvayptgdcviethkeealy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3av8B (B:)
    asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
    dqsfldddqiqagyiltcvayptgdcviethkeealy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3av8C (C:)
    asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
    dqsfldddqiqagyiltcvayptgdcviethkeealy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3av8D (D:)
    asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
    dqsfldddqiqagyiltcvayptgdcviethkeealy