PDB entry 3av7

View 3av7 on RCSB PDB site
Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PMP, KYN as substrates and KYA as products
Class: transferase
Keywords: aminotransferase, PLP binding, transamination, TRANSFERASE
Deposited on 2011-02-23, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.179
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein PH0207
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3av7a_
  • Chain 'C':
    Compound: Putative uncharacterized protein PH0207
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3av7c_
  • Heterogens: PMP, KYN, KYA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3av7A (A:)
    mgsshhhhhhssglvprgshmhedvqlniyvhsqegigmeeniksmlgdverffskkale
    mrasevrellklvetsdiislagglpnpktfpkeiirdilveimekyadkalqygttkgf
    tplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpgdivvveaptylaalqa
    fnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvptfqnpagvtmnedrrk
    yllelaseydfivveddpygelrysgnpekkikaldnegrviylgtfskilapgfrigwm
    vgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipeirkfykprrdamleal
    eefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayvpgeafyahrdvkntmr
    lnftyvdedkimegikrlaetikeelka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3av7A (A:)
    smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
    ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
    divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
    tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
    gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
    irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
    pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3av7C (C:)
    mgsshhhhhhssglvprgshmhedvqlniyvhsqegigmeeniksmlgdverffskkale
    mrasevrellklvetsdiislagglpnpktfpkeiirdilveimekyadkalqygttkgf
    tplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpgdivvveaptylaalqa
    fnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvptfqnpagvtmnedrrk
    yllelaseydfivveddpygelrysgnpekkikaldnegrviylgtfskilapgfrigwm
    vgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipeirkfykprrdamleal
    eefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayvpgeafyahrdvkntmr
    lnftyvdedkimegikrlaetikeelka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3av7C (C:)
    smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
    ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
    divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
    tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
    gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
    irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
    pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka