PDB entry 3av2

View 3av2 on RCSB PDB site
Description: The human nucleosome structure containing the histone variant H3.3
Class: structural protein/DNA
Keywords: histone-fold, DNA-binding protein, STRUCTURAL PROTEIN-DNA complex
Deposited on 2011-02-18, released 2011-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H3.3
  Species: Homo sapiens [TaxId:9606]
  Gene: H3.3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84243
  Domains in SCOPe 2.06: d3av2a_
• Chain 'B':
  Compound: histone h4
  Species: Homo sapiens [TaxId:9606]
  Gene: H4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62805 (Start-105)
• Chain 'C':
  Compound: Histone H2A type 1-B/E
  Species: Homo sapiens [TaxId:9606]
  Gene: H2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04908
• Chain 'D':
  Compound: Histone H2B type 1-J
  Species: Homo sapiens [TaxId:9606]
  Gene: H2B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06899
• Chain 'E':
  Compound: Histone H3.3
  Species: Homo sapiens [TaxId:9606]
  Gene: H3.3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84243 (Start-138)
  Domains in SCOPe 2.06: d3av2e_
• Chain 'F':
  Compound: histone h4
  Species: Homo sapiens [TaxId:9606]
  Gene: H4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62805 (Start-105)
• Chain 'G':
  Compound: Histone H2A type 1-B/E
  Species: Homo sapiens [TaxId:9606]
  Gene: H2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04908
• Chain 'H':
  Compound: Histone H2B type 1-J
  Species: Homo sapiens [TaxId:9606]
  Gene: H2B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06899
• Chain 'I':
  Compound: 146-mer DNA
  Species: synthetic, synthetic
  
• Chain 'J':
  Compound: 146-mer DNA
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3av2A (A:)
  gshmartkqtarkstggkaprkqlatkaarksapstggvkkphryrpgtvalreirryqk
  stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
  vtimpkdiqlarrirgera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3av2A (A:)
  phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqease
  aylvglfedtnlcaihakrvtimpkdiqlarrirger
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3av2E (E:)
  gshmartkqtarkstggkaprkqlatkaarksapstggvkkphryrpgtvalreirryqk
  stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
  vtimpkdiqlarrirgera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3av2E (E:)
  phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqease
  aylvglfedtnlcaihakrvtimpkdiqlarrirgera
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.