PDB entry 3av1

View 3av1 on RCSB PDB site
Description: The human nucleosome structure containing the histone variant H3.2
Class: structural protein/DNA
Keywords: histone-fold, DNA-binding protein, STRUCTURAL PROTEIN-DNA complex
Deposited on 2011-02-18, released 2011-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Homo sapiens [TaxId:9606]
    Gene: h3.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3av1a_
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: H4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Gene: H2A
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: H2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Histone H3.2
    Species: Homo sapiens [TaxId:9606]
    Gene: h3.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3av1e_
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: H4
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Gene: H2A
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: H2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 146-mer DNA
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 146-mer DNA
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3av1A (A:)
    gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
    stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3av1A (A:)
    hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
    ylvglfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3av1E (E:)
    gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
    stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3av1E (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.