PDB entry 3av1
View 3av1 on RCSB PDB site
Description: The human nucleosome structure containing the histone variant H3.2
Class: structural protein/DNA
Keywords: histone-fold, DNA-binding protein, STRUCTURAL PROTEIN-DNA complex
Deposited on
2011-02-18, released
2011-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-07-25, with a file datestamp of
2012-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Histone H3.2
Species: Homo sapiens [TaxId:9606]
Gene: h3.2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3av1a_ - Chain 'B':
Compound: histone h4
Species: Homo sapiens [TaxId:9606]
Gene: H4
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Histone H2A type 1-B/E
Species: Homo sapiens [TaxId:9606]
Gene: H2A
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Histone H2B type 1-J
Species: Homo sapiens [TaxId:9606]
Gene: H2B
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Histone H3.2
Species: Homo sapiens [TaxId:9606]
Gene: h3.2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3av1e_ - Chain 'F':
Compound: histone h4
Species: Homo sapiens [TaxId:9606]
Gene: H4
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: Histone H2A type 1-B/E
Species: Homo sapiens [TaxId:9606]
Gene: H2A
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Histone H2B type 1-J
Species: Homo sapiens [TaxId:9606]
Gene: H2B
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: 146-mer DNA
Species: synthetic, synthetic
- Chain 'J':
Compound: 146-mer DNA
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3av1A (A:)
gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera
Sequence, based on observed residues (ATOM records): (download)
>3av1A (A:)
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvglfedtnlcaihakrvtimpkdiqlarrirger
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence, based on SEQRES records: (download)
>3av1E (E:)
gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera
Sequence, based on observed residues (ATOM records): (download)
>3av1E (E:)
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.