PDB entry 3auv

View 3auv on RCSB PDB site
Description: Predicting Amino Acid Preferences in the Complementarity Determining Regions of an Antibody-Antigen Recognition Interface
Class: immune system
Keywords: sc-dsFv (disulfide-stabilized scFv), scFv, monovalent antibody, VEGF, antibody engineering, IMMUNE SYSTEM
Deposited on 2011-02-16, released 2012-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sc-dsFv derived from the G6-Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUV
    Domains in SCOPe 2.06: d3auva1, d3auva2
  • Chain 'B':
    Compound: sc-dsFv derived from the G6-Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUV
    Domains in SCOPe 2.06: d3auvb1, d3auvb2
  • Chain 'C':
    Compound: sc-dsFv derived from the G6-Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUV
    Domains in SCOPe 2.06: d3auvc1, d3auvc2
  • Chain 'D':
    Compound: sc-dsFv derived from the G6-Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUV
    Domains in SCOPe 2.06: d3auvd1, d3auvd2
  • Chain 'E':
    Compound: sc-dsFv derived from the G6-Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUV
    Domains in SCOPe 2.06: d3auve1, d3auve2
  • Chain 'F':
    Compound: sc-dsFv derived from the G6-Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUV
    Domains in SCOPe 2.06: d3auvf1, d3auvf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3auvA (A:)
    gamaqpahgsgdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliy
    sasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikgg
    gggsiegrsggggsevqlvesggglvqpggslrlscaasgftisdywihwvrqapgkcle
    wvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpya
    mdywgqgtlvtvssasaaaggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auvA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveievqlvesggglvqp
    ggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyyadsvkgrftisadt
    skntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3auvB (B:)
    gamaqpahgsgdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliy
    sasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikgg
    gggsiegrsggggsevqlvesggglvqpggslrlscaasgftisdywihwvrqapgkcle
    wvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpya
    mdywgqgtlvtvssasaaaggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auvB (B:)
    gdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvp
    srfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveievqlvesggglvq
    pggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyyadsvkgrftisad
    tskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3auvC (C:)
    gamaqpahgsgdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliy
    sasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikgg
    gggsiegrsggggsevqlvesggglvqpggslrlscaasgftisdywihwvrqapgkcle
    wvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpya
    mdywgqgtlvtvssasaaaggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auvC (C:)
    gdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvp
    srfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveievqlvesggglvq
    pggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyyadsvkgrftisad
    tskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3auvD (D:)
    gamaqpahgsgdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliy
    sasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikgg
    gggsiegrsggggsevqlvesggglvqpggslrlscaasgftisdywihwvrqapgkcle
    wvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpya
    mdywgqgtlvtvssasaaaggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auvD (D:)
    gdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvp
    srfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikevqlvesggglv
    qpggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyyadsvkgrftisa
    dtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3auvE (E:)
    gamaqpahgsgdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliy
    sasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikgg
    gggsiegrsggggsevqlvesggglvqpggslrlscaasgftisdywihwvrqapgkcle
    wvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpya
    mdywgqgtlvtvssasaaaggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auvE (E:)
    gdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvp
    srfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveievqlvesggglvq
    pggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyyadsvkgrftisad
    tskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3auvF (F:)
    gamaqpahgsgdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliy
    sasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveikgg
    gggsiegrsggggsevqlvesggglvqpggslrlscaasgftisdywihwvrqapgkcle
    wvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpya
    mdywgqgtlvtvssasaaaggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auvF (F:)
    gdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvp
    srfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveivqlvesggglvqp
    ggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyyadsvkgrftisadt
    skntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv