PDB entry 3auu

View 3auu on RCSB PDB site
Description: Crystal structure of Bacillus megaterium glucose dehydrogenase 4 in complex with D-glucose
Class: oxidoreductase
Keywords: Rossmann Fold, Oxidoreductase, NAD, Oxidation-reduction process, cytosol
Deposited on 2011-02-16, released 2012-02-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose 1-dehydrogenase 4
    Species: Bacillus megaterium [TaxId:1404]
    Gene: gdhIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39485 (8-268)
      • expression tag (7)
    Domains in SCOPe 2.05: d3auua_
  • Chain 'B':
    Compound: Glucose 1-dehydrogenase 4
    Species: Bacillus megaterium [TaxId:1404]
    Gene: gdhIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39485 (8-268)
      • expression tag (7)
    Domains in SCOPe 2.05: d3auub_
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3auuA (A:)
    mghhhhhhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkev
    eeaggqaiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkv
    idtnltgaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetl
    aleyapkgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaafla
    ssqasyvtgitlfadggmtkypsfqagrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auuA (A:)
    hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
    iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
    aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
    girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
    tgitlfadggmtkypsfqagrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3auuB (B:)
    mghhhhhhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkev
    eeaggqaiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkv
    idtnltgaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetl
    aleyapkgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaafla
    ssqasyvtgitlfadggmtkypsfqagrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3auuB (B:)
    hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
    iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
    aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
    girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
    tgitlfadggmtkypsfqagrg