PDB entry 3aut

View 3aut on RCSB PDB site
Description: Crystal structure of Bacillus megaterium glucose dehydrogenase 4 in complex with NADH
Class: oxidoreductase
Keywords: Rossmann Fold, Oxidoreductase, NAD, Oxidation-reduction process, Cytosol
Deposited on 2011-02-16, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose 1-dehydrogenase 4
    Species: Bacillus megaterium [TaxId:1404]
    Gene: gdhIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39485 (8-268)
      • expression tag (7)
    Domains in SCOPe 2.07: d3auta1, d3auta2
  • Chain 'B':
    Compound: Glucose 1-dehydrogenase 4
    Species: Bacillus megaterium [TaxId:1404]
    Gene: gdhIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39485 (8-268)
      • expression tag (7)
    Domains in SCOPe 2.07: d3autb1, d3autb2
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3autA (A:)
    mghhhhhhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkev
    eeaggqaiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkv
    idtnltgaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetl
    aleyapkgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaafla
    ssqasyvtgitlfadggmtkypsfqagrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3autA (A:)
    hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
    iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
    aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
    girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
    tgitlfadggmtkypsfqagrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3autB (B:)
    mghhhhhhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkev
    eeaggqaiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkv
    idtnltgaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetl
    aleyapkgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaafla
    ssqasyvtgitlfadggmtkypsfqagrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3autB (B:)
    hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
    iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
    aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
    girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
    tgitlfadggmtkypsfqagrg