PDB entry 3auc

View 3auc on RCSB PDB site
Description: A simplified BPTI variant with poly SER (C5S) amino acid tag at the c-terminus
Class: hydrolase inhibitor
Keywords: Serine protease inhibitor, inhibits serine protease, trypsin, HYDROLASE INHIBITOR
Deposited on 2011-02-03, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUC (0-End)
    Domains in SCOPe 2.07: d3auca_
  • Chain 'B':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUC (0-End)
    Domains in SCOPe 2.07: d3aucb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aucA (A:)
    rpafcleppyagpgkariiryfynaaagaaqtfvyggvrakrnnfasaadalaacaaagg
    sssss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aucA (A:)
    rpafcleppyagpgkariiryfynaaagaaqtfvyggvrakrnnfasaadalaacaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aucB (B:)
    rpafcleppyagpgkariiryfynaaagaaqtfvyggvrakrnnfasaadalaacaaagg
    sssss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aucB (B:)
    rpafcleppyagpgkariiryfynaaagaaqtfvyggvrakrnnfasaadalaaca