PDB entry 3aub

View 3aub on RCSB PDB site
Description: A simplified BPTI variant stabilized by the A14G and A38V substitutions
Class: hydrolase inhibitor
Keywords: Serine protease inhibitor, hydrolase inhibitor, Trypsin
Deposited on 2011-02-03, released 2012-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.167
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUB (0-57)
    Domains in SCOPe 2.08: d3auba_
  • Chain 'B':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUB (0-57)
    Domains in SCOPe 2.08: d3aubb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aubA (A:)
    rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aubB (B:)
    rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa