PDB entry 3atu

View 3atu on RCSB PDB site
Description: Crystal structure of human Hsp70 NBD in the ADP- and Mg ion-bound state
Class: Hydrolase
Keywords: Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ATPase, ADP binding, Hydrolase
Deposited on 2011-01-13, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.187
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock 70 kDa protein 1A/1B
    Species: Homo sapiens [TaxId:9606]
    Gene: Hsp70, HSPA1, HSPA1A, HSPA1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3atua1, d3atua2
  • Heterogens: ADP, PO4, MG, NA, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3atuA (A:)
    gsftmakaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaak
    nqvalnpqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafyp
    eeissmvltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriinep
    taaaiaygldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnr
    lvnhfveefkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfyts
    itrarfeelcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffng
    rdlnksinpdeavaygaavqaailmgdksenv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3atuA (A:)
    aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
    qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
    ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
    gldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfve
    efkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfe
    elcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksi
    npdeavaygaavqaailmg