PDB entry 3atp

View 3atp on RCSB PDB site
Description: Structure of the ligand binding domain of the bacterial serine chemoreceptor Tsr with ligand
Class: signaling protein
Keywords: Chemoreceptor, serine biniding, membrane, SIGNALING PROTEIN
Deposited on 2011-01-07, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.258
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein I
    Species: Escherichia coli [TaxId:316407]
    Gene: tsr, cheD, b4355, JW4318
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3atpa_
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein I
    Species: Escherichia coli [TaxId:316407]
    Gene: tsr, cheD, b4355, JW4318
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3atpb_
  • Heterogens: SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3atpA (A:)
    gplgsgglffnalkndkenftvlqtirqqqstlngswvallqtrntlnragirymmdqnn
    igsgstvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeli
    qllgagkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnnasys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3atpA (A:)
    nftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvaelmesasisl
    kqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkineffdqptqg
    yqdgfekqyvaymeqndrlhdiavsdnnasy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3atpB (B:)
    gplgsgglffnalkndkenftvlqtirqqqstlngswvallqtrntlnragirymmdqnn
    igsgstvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeli
    qllgagkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnnasys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3atpB (B:)
    enftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvaelmesasis
    lkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkineffdqptq
    gyqdgfekqyvaymeqndrlhdiavsdnnas