PDB entry 3atk

View 3atk on RCSB PDB site
Description: Crystal structure of trypsin complexed with cycloheptanamine
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, SERINE PROTEASE, PROTEIN, INHIBITOR, BOVINE PANCREAS, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-05, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.164
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3atka_
  • Heterogens: CA, DMS, SZ1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3atkA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn