PDB entry 3atf

View 3atf on RCSB PDB site
Description: Crystal Structure of the Kir3.2 Cytoplasmic Domain (Na+-free crystal soaked in 200 mM Cesium chloride)
Class: transport protein
Keywords: Cytoplasmic assembly, beta-barrel, ion transport, G protein beta-gamma subunits, TRANSPORT PROTEIN
Deposited on 2010-12-28, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium inwardly-rectifying channel, subfamily J, member 6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3atfa_
  • Heterogens: CS, MG, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3atfA (A:)
    gshmrkiqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnsh
    iveasiraklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfwe
    iskaqlpkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdy
    nsfhetyetstpslsakelaelanrael
    

    Sequence, based on observed residues (ATOM records): (download)
    >3atfA (A:)
    qryvrkdgkcnvhhgnvrtlvfsthavismrdgklclmfrvgdlrnshiveasiraklik
    skqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpkeele
    ivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyetstp
    slsakelaelanr