PDB entry 3atd

View 3atd on RCSB PDB site
Description: Crystal Structure of the Kir3.2 Cytoplasmic Domain (Na+-free crystal soaked in 10 mM Gadolinium chloride and 10 mM magnesium chloride)
Class: transport protein
Keywords: Cytoplasmic assembly, beta-barrel, ion transport, G protein beta-gamma subunits, TRANSPORT PROTEIN
Deposited on 2010-12-28, released 2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.256
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium inwardly-rectifying channel, subfamily J, member 6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3atda_
  • Heterogens: GD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3atdA (A:)
    gshmrkiqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnsh
    iveasiraklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfwe
    iskaqlpkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdy
    nsfhetyetstpslsakelaelanrael
    

    Sequence, based on observed residues (ATOM records): (download)
    >3atdA (A:)
    iqryvrkdgkcnvhhgnvraetlvfsthavismrdgklclmfrvgdlrnshiveasirak
    likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke
    eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet
    stpslsakelaelanr