PDB entry 3asv

View 3asv on RCSB PDB site
Description: The Closed form of serine dehydrogenase complexed with NADP+
Class: oxidoreductase
Keywords: SDR family, Rossmann fold, short-chain dehydrogenase/reductase, L-allo-threonine dehydrogenase, OXIDOREDUCTASE
Deposited on 2010-12-21, released 2011-10-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_2106, YdfG
    Database cross-references and differences (RAF-indexed):
    • PDB 3ASV (0-247)
    Domains in SCOPe 2.05: d3asva_
  • Chain 'B':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_2106, YdfG
    Database cross-references and differences (RAF-indexed):
    • PDB 3ASV (0-247)
    Domains in SCOPe 2.05: d3asvb_
  • Chain 'C':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_2106, YdfG
    Database cross-references and differences (RAF-indexed):
    • PDB 3ASV (0-247)
    Domains in SCOPe 2.05: d3asvc_
  • Chain 'D':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_2106, YdfG
    Database cross-references and differences (RAF-indexed):
    • PDB 3ASV (0-247)
    Domains in SCOPe 2.05: d3asvd_
  • Chain 'E':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_2106, YdfG
    Database cross-references and differences (RAF-indexed):
    • PDB 3ASV (0-247)
    Domains in SCOPe 2.05: d3asve_
  • Chain 'F':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_2106, YdfG
    Database cross-references and differences (RAF-indexed):
    • PDB 3ASV (0-247)
    Domains in SCOPe 2.05: d3asvf_
  • Heterogens: NAP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3asvA (A:)
    mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
    ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
    mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
    ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
    aglnvhrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3asvB (B:)
    mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
    ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
    mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
    ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
    aglnvhrq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3asvC (C:)
    mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
    ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
    mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
    ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
    aglnvhrq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3asvD (D:)
    mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
    ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
    mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
    ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
    aglnvhrq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3asvE (E:)
    mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
    ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
    mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
    ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
    aglnvhrq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3asvF (F:)
    mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
    ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
    mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
    ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
    aglnvhrq