PDB entry 3ase

View 3ase on RCSB PDB site
Description: Crystal Structure of Zinc myoglobin soaked with Ru3O cluster
Class: oxygen transport
Keywords: Electron transfer, OXYGEN TRANSPORT
Deposited on 2010-12-11, released 2011-04-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.203
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • see remark 999 (122)
    Domains in SCOPe 2.03: d3asea_
  • Heterogens: SO4, RUO, ZNH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aseA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg