PDB entry 3asa

View 3asa on RCSB PDB site
Description: Crystal structure of apo-LL-diaminopimelate aminotransferase from Chlamydia trachomatis
Class: transferase
Keywords: PLP dependent aminotransferase, TRANSFERASE
Deposited on 2010-12-10, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.229
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LL-diaminopimelate aminotransferase
    Species: Chlamydia trachomatis [TaxId:813]
    Gene: dapL, aspC, CT_390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3asaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3asaA (A:)
    mkrnphfvsltknylfadlqkrvaqfrlenpqhtvinlsigdttqplnasvaeafassia
    rlsspttcrgygpdfglpalrqklsedfyrgfvdakeifisdgakvdlfrllsffgpnqt
    vaiqdpsypayldiarltgakeiialpclqenaffpefpedthidilclcspnnptgtvl
    nkdqlraivhyaieheililfdaaystfisdpslpksifeipdarfcaieinsfskplgf
    agirlgwtvipqeltyadghfviqdwerflsttfngasipaqeagvaglsilpqleaihy
    yrensdllrkallatgfevfggehapylwvkptqanisdrdlfdfflreyhiaitpgigf
    grsgsgfvrfsslgkredilaacerlqmapalqshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3asaA (A:)
    mkrnphfvsltknylfadlqkrvaqfrlenpqhtvinlsigdttqplnasvaeafassia
    rlsspttcrgygpdfglpalrqklsedfyrgfvdakeifisdgakvdlfrllsffgpnqt
    vaiqdpsypayldiarltgakeiialpclqenaffpefpedthidilclcspnnptgtvl
    nkdqlraivhyaieheililfdaaystfisdpslpksifeipdarfcaieinsfskplgf
    agirlgwtvipqeltyadghfviqdwerflsttfngasipaqeagvaglsilpqleaihy
    yrensdllrkallatgfevfggehapylwvkptqanisdrdlfdfflreyhiaitpgigf
    grsgsgfvrfsslgkredilaacerlqm