PDB entry 3arl

View 3arl on RCSB PDB site
Description: Cl- binding hemoglobin component V form Propsilocerus akamusi under 500 mM NaCl at pH 5.5
Class: oxygen transport
Keywords: Propsilocerus akamusi, insect hemoglobin, chloride ion binding, OXYGEN TRANSPORT
Deposited on 2010-12-02, released 2011-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin v
  Species: Tokunagayusurika akamusi [TaxId:28383]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M422 (0-151)
  Domains in SCOPe 2.08: d3arla_
• Heterogens: HEM, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3arlA (A:)
  afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
  anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
  ldsthgaawnkmmdnffyvfyecldgrcsqfs