PDB entry 3aq4

View 3aq4 on RCSB PDB site
Description: Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
Class: toxin
Keywords: ADP-ribosylation factor, miRNA processing machineries, toxin, ADP-ribosylation
Deposited on 2010-10-25, released 2011-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3aq4a_
  • Chain 'B':
    Compound: ADP-ribosylation factor 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3aq4b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aq4A (A:)
    gshmglsfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetve
    yknisftvwdvggqdkirplwrhyfqntqglifvvdsndrdrvveardelhrmlnedelr
    davllvfankqdlpnamnaaeitdklglhslrqrhwyiqstcatsgeglyegldwlsnni
    aska
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aq4A (A:)
    sfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisf
    tvwdvglwrhyfqntqglifvvdsndrdrvveardelhrmlnedelrdavllvfankqdl
    pnamnaaeitdklglhslrqrhwyiqstcatsgeglyegldwlsnniask
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aq4B (B:)
    gshmglsfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetve
    yknisftvwdvggqdkirplwrhyfqntqglifvvdsndrdrvveardelhrmlnedelr
    davllvfankqdlpnamnaaeitdklglhslrqrhwyiqstcatsgeglyegldwlsnni
    aska
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aq4B (B:)
    sfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisf
    tvwdvgntqglifvvdsndrdrvveardelhrmlnedelrdavllvfankqdlpnamnaa
    eitdklglhslrqrhwyiqstcatsgeglyegldwlsnniask