SCOPe 2.05: Structural Classification of Proteins

PDB entry 3apy

View 3apy on RCSB PDB site
Description: Properties and crystal structure of methylenetetrahydrofolate reductase from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: tim barrel, oxidoreductase, flavin
Deposited on 2010-10-21, released 2011-09-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apya_
Chain 'B':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apyb_
Chain 'C':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apyc_
Chain 'D':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apyd_
Chain 'E':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apye_
Chain 'F':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apyf_
Chain 'G':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apyg_
Chain 'H':
Compound: Methylenetetrahydrofolate reductase
Species: Thermus thermophilus [TaxId:300852]
Gene: TTHA0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLG6 (0-End)
Domains in SCOPe 2.05: d3apyh_
Heterogens: FAD, CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3apyA (A:)
mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrpasgqpakla
aalehhhhhh