PDB entry 3apg

View 3apg on RCSB PDB site
Description: Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
Class: hydrolase
Keywords: TIM barrel, Hydrolase, Sugar binding, Hydrolysis
Deposited on 2010-10-15, released 2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d3apga1, d3apga2
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d3apgb1, d3apgb2
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d3apgc1, d3apgc2
  • Chain 'D':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d3apgd1, d3apgd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3apgA (A:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apgA (A:)
    akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
    ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
    ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldekt
    vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnl
    iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
    wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
    nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
    gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3apgB (B:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apgB (B:)
    akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
    ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
    ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldekt
    vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnl
    iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
    wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
    nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
    gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3apgC (C:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apgC (C:)
    akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
    ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
    ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldekt
    vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnl
    iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
    wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
    nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
    gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3apgD (D:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apgD (D:)
    akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
    ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
    ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldekt
    vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnl
    iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
    wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
    nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
    gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr