PDB entry 3apc

View 3apc on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with CH5132799
Class: Transferase/Transferase inhibitor
Keywords: phosphoinositide 3-kinase gamma, Kinase, Transferase, Transferase-Transferase inhibitor complex
Deposited on 2010-10-14, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3apca1, d3apca2, d3apca3, d3apca4
  • Heterogens: MMD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3apcA (A:)
    gplhmgsseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpkly
    amhpwvtskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkk
    slmdipesqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpald
    evrkeewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprn
    tdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycg
    kapalsskasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgs
    fnadkltsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqle
    aiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrev
    wdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsa
    larfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqv
    qviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagal
    aiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwe
    tesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkeksp
    teekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksfl
    ginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlm
    tgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikq
    gekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apcA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaseqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidi
    pvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgalln
    lqiycvqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisil
    ldempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
    vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
    vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
    cgtamlhdftqqvqviemlqkvtldikslsadvssqvisqlkqklenlqnsqlpesfrvp
    ydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilq
    ilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdev
    lnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfg
    hilgnkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmm
    lmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlg