PDB entry 3apb

View 3apb on RCSB PDB site
Description: Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with iodide
Class: Sugar Binding Protein
Keywords: Beta-Sandwich, Galectin, Carbohydrate/Sugar Binding, Sugar Binding Protein
Deposited on 2010-10-14, released 2011-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.203
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (Start-153)
      • see remark 999 (55)
    Domains in SCOPe 2.05: d3apba_
  • Chain 'B':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (Start-153)
      • see remark 999 (55)
    Domains in SCOPe 2.05: d3apbb_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3apbA (A:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apbA (A:)
    lslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradv
    afhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkh
    tllyghrigpekidtlgiygkvnihsigfsfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3apbB (B:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3apbB (B:)
    lslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradv
    afhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkh
    tllyghrigpekidtlgiygkvnihsigfsfs