PDB entry 3ap5

View 3ap5 on RCSB PDB site
Description: Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain
Class: Sugar Binding Protein
Keywords: Beta-Sandwich, Galectin, Carbohydrate/Sugar Binding, Sugar Binding Protein
Deposited on 2010-10-11, released 2011-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (Start-153)
      • see remark 999 (55)
    Domains in SCOPe 2.05: d3ap5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ap5A (A:)
mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpra
dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
khtllyghrigpekidtlgiygkvnihsigfsfs

    Sequence, based on observed residues (ATOM records): (download) 
    >3ap5A (A:)
lslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradv
afhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkh
tllyghrigpekidtlgiygkvnihsigfsfs