PDB entry 3aok

View 3aok on RCSB PDB site
Description: Crystal structure of sweet-tasting protein thaumatin II
Class: plant protein
Keywords: thaumatin family, mainly beta, taste protein, sweet receptor, aril, PLANT PROTEIN
Deposited on 2010-10-01, released 2011-07-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: 0.112
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-2
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3aoka_
  • Heterogens: TLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3aokA (A:)
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgrgicrtgdcggllqckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta