PDB entry 3aog

View 3aog on RCSB PDB site
Description: Crystal structure of glutamate dehydrogenase (GdhB) from Thermus thermophilus (Glu bound form)
Class: oxidoreductase
Keywords: glutamate dehydrogenase, dehydrogenase, NAD(H), OXIDOREDUCTASE
Deposited on 2010-09-28, released 2011-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.228
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aoga1, d3aoga2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogb1, d3aogb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogc1, d3aogc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogd1, d3aogd2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aoge1, d3aoge2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogf1, d3aogf2
  • Chain 'G':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogg1, d3aogg2
  • Chain 'H':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogh1, d3aogh2
  • Chain 'I':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogi1, d3aogi2
  • Chain 'J':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogj1, d3aogj2
  • Chain 'K':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogk1, d3aogk2
  • Chain 'L':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aogl1, d3aogl2
  • Heterogens: GLU, PO4, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aogA (A:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogA (A:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aogB (B:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogB (B:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3aogC (C:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogC (C:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3aogD (D:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogD (D:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3aogE (E:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogE (E:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3aogF (F:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogF (F:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3aogG (G:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogG (G:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3aogH (H:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogH (H:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3aogI (I:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogI (I:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3aogJ (J:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogJ (J:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3aogK (K:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogK (K:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvqdfnsy
    fwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrglyp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3aogL (L:)
    mgsshhhhhhsqdpnsmkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpk
    rvlivdvpvrlddgsvayfegyrvhhntargpakggvryhpevtlsevmalagwmtikna
    avglpygggkggirvdprklspgelerltrrytseigillgpdrdipapdvntgeremaw
    mmdtysmnvgrtvpgvvtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvai
    qgfgnvgnaaarafhdhgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaep
    lpaadfwglpveflvpaalekqiteqnawrirarivaegangpttpaaddillekgvlvv
    pdvianaggvtvsyfewvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrta
    ayvvaatrvlearalrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aogL (L:)
    eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
    egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
    lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
    kpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhga
    rvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaal
    ekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvq
    dfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgly
    p