PDB entry 3aoe

View 3aoe on RCSB PDB site
Description: Crystal structure of hetero-hexameric glutamate dehydrogenase from Thermus thermophilus (Leu bound form)
Class: oxidoreductase
Keywords: Rossmann fold, glutamate dehydrogenase, dehydrogenase, NADH, OXIDOREDUCTASE
Deposited on 2010-09-27, released 2011-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gdhB, TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3aoea1, d3aoea2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gdhB, TT_C1211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3aoeb1, d3aoeb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gdhA, TT_C1212
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gdhA, TT_C1212
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gdhA, TT_C1212
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gdhA, TT_C1212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aoeA (A:)
    mkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsv
    ayfegyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvd
    prklspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgv
    vtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhd
    hgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvp
    aalekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfe
    wvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalr
    glyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aoeA (A:)
    seplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvay
    fegyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdpr
    klspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvt
    gkpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhg
    arvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaa
    lekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewv
    qdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrgl
    yp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aoeB (B:)
    mkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsv
    ayfegyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvd
    prklspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgv
    vtgkpialggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhd
    hgarvvavqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvp
    aalekqiteqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfe
    wvqdfnsyfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalr
    glyp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.