PDB entry 3anv

View 3anv on RCSB PDB site
Description: Crystal structure of D-serine dehydratase from chicken kidney (2,3-DAP complex)
Class: lyase
Keywords: PLP-dependent fold-type III enzyme, D-serine dehydratase, PLP binding, Zinc binding, LYASE
Deposited on 2010-09-09, released 2011-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-serine dehydratase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3anva1, d3anva2
  • Heterogens: PLP, CL, ZN, 2RA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3anvA (A:)
    mwlgalldtlptpaltidrttarrnaermrercralgvrlrphvkthktleggllatggt
    rrgiavstlaearffadggfddillaypvptarleecaglarrldafhvlldrpealasl
    rqrplghgkrwlvwlkldcgngragvrptdpaalelaqaiandapeevtlvgvyahcgnt
    ygcsgadtiqaiartttnavlsfvaalrqagvpcpqasigstpscshpipemsqltelhp
    gnyifydlqqtqlgscqpqdvairvltrvighyahrgqllvdcgwaalslhgagagqgpq
    gcaaidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyv
    heegkvvalwhpvrgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3anvA (A:)
    wlgalldtlptpaltidrttarrnaermrercralgvrlrphvkthktleggllatggtr
    rgiavstlaearffadggfddillaypvptarleecaglarrldafhvlldrpealaslr
    qrplghgkrwlvwlkldcgngragvrptdpaalelaqaiandapeevtlvgvyahcgnty
    gcsgadtiqaiartttnavlsfvaalrqagvpcpqasigstpscshpipemsqltelhpg
    nyifydlqqtqlgscqpqdvairvltrvighyahrgqllvdcgwaalslhgagagpqgca
    aidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvhee
    gkvvalwhpvrgw