PDB entry 3anj

View 3anj on RCSB PDB site
Description: Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae
Class: hydrolase
Keywords: alpha6/alpha6-barrel, HYDROLASE
Deposited on 2010-09-02, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein gbs1889
    Species: Streptococcus agalactiae [TaxId:216495]
    Gene: gbs1889, Ugl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3anja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3anjA (A:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgfly
    tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
    qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
    desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
    qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
    hgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3anjA (A:)
    mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
    kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgflyt
    psctaeyringdvkaleatikaadklmerliidcllniqllffayeqtgdekyrqvavnh
    fyasannvvrddssafhtfyfdpetgeplkgvtrqgysdesswargqawgiygiplsyrk
    mkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgqprdtsatatavcgihemlkyl
    pevdpdketykyamhtmlrslieqysnneliagrplllhgvyswhsgkgvdegniwgdyy
    ylealirfykdwelyw