PDB entry 3amz

View 3amz on RCSB PDB site
Description: Bovine Xanthine Oxidoreductase urate bound form
Class: oxidoreductase
Keywords: reaction intermediate, OXIDOREDUCTASE
Deposited on 2010-08-27, released 2010-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.153
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3amzA (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3amzA (A:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkldptytsatllfqkhppaniqlfqevpngqskedtvgrp
    lphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcfls
    addipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpaii
    tiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipkge
    egemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvavalaa
    yktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdlshs
    imeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtcgl
    paeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwkkr
    glciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskalki
    piskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswedw
    vmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknlrt
    divmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgsip
    tefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelfrl
    dspatpekirnacvdkfttlcvtgkpwslrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3amzB (B:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3amzB (B:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkldptytsatllfqkhppaniqlfqevpngqskedtvgrp
    lphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcfls
    addipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpaii
    tiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipkge
    egemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvavalaa
    yktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdlshs
    imeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtcgl
    paeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwkkr
    glciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskalki
    piskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswedw
    vmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknlrt
    divmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgsip
    tefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelfrl
    dspatpekirnacvdkfttlcvkpwslrv